Research Use Only / Third-Party Analytical Testing / Per-Batch Documentation / Materials Shipped from the USA
Search Account 0 Cart
IGF-1 LR3 research material
Vial · Research materialHelio®
Helio / Materials / Growth Hormone
Growth Hormone Research

IGF-1 LR3

IGF-1 LR3 (Long R3 Insulin-like Growth Factor-1) is an 83-amino-acid analog of human IGF-1 engineered for extended activity in research systems. It differs from the 70-residue native protein by two modifications: a 13-amino-acid N-terminal extension and an arginine-for-glutamic-acid substitution at position 3. Together these changes reduce binding to IGF-binding proteins (IGFBPs), leaving more free analog available to engage the IGF-1 receptor and substantially increasing functional potency and half-life relative to native IGF-1 in model systems.

As a ligand for the IGF-1 receptor, IGF-1 LR3 is widely used as a research tool for probing IGF-1R-mediated signaling, including pathways governing cell proliferation, protein synthesis and survival. It sits downstream of the GH/GHRH axis and is frequently studied alongside GHRH analogs and secretagogues to model the full GH/IGF-1 signaling cascade. Supplied as a lyophilized powder for research use only.

Identification
  • MaterialIGF-1 LR3
  • Research AreaGrowth Hormone
  • PresentationVial
  • Available Sizes1mg
  • CAS Number946870-92-4
  • Molecular FormulaC400H625N111O115S9
  • Molecular Weight9111.46 g/mol
  • TypeRecombinant/synthetic protein (Long R3 IGF-1 analog)
  • Receptor / TargetInsulin-like growth factor 1 receptor (IGF-1R)
Amino Acid Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Analytical Data
  • Purity (HPLC)≥99%
  • Identity (MS)Confirmed to specification
  • TestingAccredited (ISO 17025) third-party laboratory
  • DocumentationPer-batch COA →
From$59.95

Research use only — not for human or animal consumption. Per-batch documentation is provided with the material.

Key Characteristics
Molecular FormulaC400H625N111O115S9
Molecular Weight9111.46 g/mol
CAS Number946870-92-4
Structure83-amino-acid IGF-1 analog: 13-residue N-terminal extension + Arg3 substitution
Receptor / TargetIGF-1 receptor (IGF-1R)
FormLyophilized powder (vial)
SolubilitySoluble in dilute acetic acid; moderate aqueous solubility at neutral pH
StorageLyophilized: -20 C to -80 C, protected from light; short-term 4 C acceptable
StabilityLyophilized powder stable long-term when frozen; reconstituted solution should be refrigerated and used promptly; avoid repeated freeze-thaw
Research Context
IGF-1R signaling researchUsed as a potent IGF-1R agonist to study PI3K/Akt and MAPK signaling in cultured cells.
Cell proliferation and growth modelsApplied in studies of proliferation, differentiation and protein synthesis across multiple tissue-derived cell lines.
IGFBP-independent studiesValued for reduced IGF-binding-protein affinity, enabling investigation of IGF-1R engagement with minimal IGFBP sequestration.
GH/IGF-1 axis modelingStudied as the downstream effector arm alongside GHRH analogs and secretagogues in integrated GH-axis research.
Cell-culture supplementation researchInvestigated as a supplement in serum-free and reduced-serum culture systems for its proliferative signaling.
Research Findings

Research on IGF-1 LR3 has established that its N-terminal extension and Arg3 substitution markedly lower affinity for IGF-binding proteins, increasing the fraction of free analog available to activate the IGF-1 receptor. In cell-culture systems this translates to substantially greater proliferative and biosynthetic potency than native IGF-1, together with a longer functional half-life.

Because of these properties, Long R3 IGF-1 is widely used as a research-grade growth supplement and IGF-1R agonist in cell biology, particularly where robust and sustained receptor activation is desired with minimal interference from binding proteins.

History

IGF-1 LR3 was developed to overcome the IGFBP-mediated limitations of native IGF-1, combining the previously described Arg3 ("R3") substitution with an N-terminal peptide extension to further reduce binding-protein affinity. It has since become a standard high-potency IGF-1R agonist in research and biomanufacturing cell-culture applications.

References
  1. Francis GL, et al. Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency. J Mol Endocrinol. 1992;8(3):213-223.
  2. Tomas FM, et al. Insulin-like growth factor-I (IGF-I) and especially IGF-I variants are anabolic in dexamethasone-treated rats. Biochem J. 1992;282(Pt 1):91-97.
  3. Sepp-Lorenzino L. Structure and function of the insulin-like growth factor I receptor. Breast Cancer Res Treat. 1998;47(3):235-253.

Cited literature refers to laboratory and preclinical research. IGF-1 LR3 is supplied strictly for research use only and is not intended to diagnose, treat, cure, or prevent any disease.

Why researchers choose Helio
99%+ PurityHPLC-verified every batch
Accredited TestingIndependent ISO 17025 laboratory
Per-Batch COADocumentation tied to your lot
Made in the USADiscreet, protected shipping
Related

More in Growth Hormone

View area →